Recombinant Mouse C-X-C motif chemokine 11 protein
Référence OPCA00811-100UG
Conditionnement : 100ug
Marque : Aviva Systems Biology
SCYB11 Recombinant Protein (Mouse) (OPCA00811)
| Datasheets/Manuals | Printable datasheet for SCYB11 Recombinant Protein (Mouse) (OPCA00811) |
|---|
| Predicted Species Reactivity | Mouse|Mus musculus |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Additional Information | Tag information : His tag |
| Reconstitution and Storage | -20°C or -80°C |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQ |
| Protein Sequence | FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQ |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 22-98 aa |
| Tag | N-terminal 6xHis-tagged |
| Reference | The murine chemokine CXCL11 (IFN-inducible T cell alpha chemoattractant) is an IFN-gamma- and lipopolysaccharide-inducible glucocorticoid-attenuated response gene expressed in lung and other tissues during endotoxemia.Widney D.P., Xia Y.-R., Lusis A.J., Smith J.B.J. Immunol. 164:6322-6331(2000) |
|---|---|
| Gene Symbol | Cxcl11 |
| Gene Full Name | chemokine (C-X-C motif) ligand 11 |
| Alias Symbols | b-R, b-R1, betaR1, C-X-C motif chemokine 11, Cxc11, H174, I, I-T, I-tac, interferon-inducible T-cell alpha chemoattractant, Ip9, IT, Itac, Scyb1, Scyb11, SCYB9, Scyb9b, small inducible cytokine subfamily B (Cys-X-Cys), member 11, small-inducible cytokine B11. |
| NCBI Gene Id | 56066 |
| Protein Name | C-X-C motif chemokine 11 |
| Description of Target | Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses (By similarity). |
| Uniprot ID | Q9JHH5 |
| Protein Size (# AA) | Partial |
| Molecular Weight | 12.9 kDa |




