RecombinantEPO,Human

Référence orb1494750-10ug

Conditionnement : 10ug

Marque : Biorbyt

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

RecombinantEPO,Human

SKU: orb1494750

Description

Erythropoietin (EPO), a glycoprotein produced primarily by the kidney, is the principal factor that regulates erythropoiesis by stimulating the proliferation and differentiation of erythroid progenitor cells. The production of EPO by kidney cells is increased in response to hypoxia or anemia. Recombinant EPO has been approved for the treatment of anemia associated with chronic renal failure as well as for anemia of AZT treated AIDS patients.The cDNAs for EPO have been cloned from human, mouse, canine, etc. The mature proteins from the various species are highly conserved, exhibiting greater than 80% sequence identity at the amino acid level. Human EPO cDNA encodes a 193 amino acid residue precursor protein that is processed to yield a 165 amino acid residue mature protein. EPO contains one O-linked and three N-linked glycosylation sites. Glycosylation of EPO is required for EPO biological activities in vivo. EPO exhibits structural as well as amino sequence identity to the amino terminal 153 amino acid region of thrombopoietin.

Images & Validation

Application Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

SourceCHO
Biological ActivityED501 x 10ˆ6units/mg
Purification> 95% as analyzed by SDS-PAGE and HPLC.
Endotoxins< 0.2 EU/μg, determined by LAL method.
MWMature human EPO, containing 166 amino acid residues, has a predicted molecular mass of approximately 21 kDa. As a result of glycosylation, the recombinant protein migrates with an apparent molecular mass of 26-36 kDa in SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Protein SequenceAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAL LVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEA CRTGDR

Storage & Handling

StorageLyophilized recombinant human EPO remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhEPO should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Human EPO-alpha, EPO-alpha, EPO alpha, EPOalpha, h-EPO-alpha, rh-AEPO-alpha, recombinant human EPO-alpha, recombinant EPO-alpha, EPO.

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Vous serez peut-être également intéressé par les produits suivants :



Référence
Description
Cond.
Prix HT