ST3GAL3 antibody - C-terminal region
Référence ARP46705_T100
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
ST3GAL3 Antibody - C-terminal region (ARP46705_T100)
| Datasheets/Manuals | Printable datasheet for anti-ST3GAL3 (ARP46705_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ST3GAL3 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: GFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITD |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-ST3GAL3 (ARP46705_T100) antibody is Catalog # AAP46705 (Previous Catalog # AAPP27507) |
| Gene Symbol | ST3GAL3 |
|---|---|
| Gene Full Name | ST3 beta-galactoside alpha-2,3-sialyltransferase 3 |
| Alias Symbols | ST3N, DEE15, MRT12, SIAT6, EIEE15, ST3GALII, ST3GalIII, ST3Gal III |
| NCBI Gene Id | 6487 |
| Protein Name | CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase |
| Description of Target | ST3GAL3 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL3 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Multiple transcript variants encoding several different isoforms have been found for this gene. |
| Uniprot ID | Q11203 |
| Protein Accession # | EAX07084 |
| Nucleotide Accession # | NM_001270459 |
| Protein Size (# AA) | 268 |
| Molecular Weight | 30kDa |
| Protein Interactions | RPL8; ZBTB5; SCAMP2; TTR; ACTG1; |
