TBX5 (T-box Transcription Factor TBX5, T-box Protein 5)
Référence 134268-100ug
Conditionnement : 100ug
Marque : US Biological
134268 TBX5 (T-box Transcription Factor TBX5, T-box Protein 5)
Clone Type
MonoclonalHost
mouseSource
humanIsotype
IgG1,kGrade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
BC027942, AAH27942Shipping Temp
Blue IceStorage Temp
-20°CT-box transcription factors contain a novel type of DNA-binding domain, the T-box domain, which are encoded by an ancient gene family. Four T-box genes, omb, Trg, org-1, and H15, have been identified in Drosophila, whereas in mammals the T-box gene family has expanded, and 12 human T-box genes have been isolated. Most T-box genes have discrete spatial and temporal patterns of expression during embryogenesis. T-box 5 (TBX5) is the human homolog of mouse Tbx5, which is closely linked to Tbx3 on mouse chromosome 5. Similarly, both this gene and TBX3 map to human chromosome 12. Expression studies in mouse and chicken show that Tbx5 is expressed in developing forelimb, but not in hindlimb buds, suggesting a role for this gene in regulating limb development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene.
Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilutions:
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence:
PSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSDNS
Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

