- Specifications
Product Description
Human TNFSF14 full-length ORF ( NP_742011.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
48.8
Interspecies Antigen Sequence
Mouse (66); Rat (68)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — TNFSF14
Entrez GeneID
8740GeneBank Accession#
NM_172014.1Protein Accession#
NP_742011.1Gene Name
TNFSF14
Gene Alias
CD258, HVEML, LIGHT, LTg, TR2
Gene Description
tumor necrosis factor (ligand) superfamily, member 14
Omim ID
604520Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
delta transmembrane LIGHT|herpesvirus entry mediator A|ligand for herpesvirus entry mediator|tumor necrosis factor ligand superfamily, member 14|tumor necrosis factor receptor-like 2|tumor necrosis factor superfamily member LIGHT
- Interactomes
- Pathways
- Diseases
TNFSF14 (Human) Recombinant Protein (P02)
Référence H00008740-P02-25ug
Conditionnement : 25ug
Marque : Abnova
Images


