TRAPPC1 Antibody - middle region - Biotin
Référence ARP57531_P050-Biotin
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
TRAPPC1 Antibody - middle region : Biotin (ARP57531_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-TRAPPC1 (ARP57531_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TRAPPC1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-TRAPPC1 (ARP57531_P050-Biotin) antibody is Catalog # AAP57531 (Previous Catalog # AAPP41643) |
| Subunit | 1 |
| Gene Symbol | TRAPPC1 |
|---|---|
| Gene Full Name | Trafficking protein particle complex 1 |
| Alias Symbols | BET5, MUM2 |
| NCBI Gene Id | 58485 |
| Protein Name | Trafficking protein particle complex subunit 1 |
| Description of Target | This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants. |
| Uniprot ID | Q2KMM2 |
| Protein Accession # | NP_067033 |
| Nucleotide Accession # | NM_021210 |
| Protein Size (# AA) | 145 |
| Molecular Weight | 17kDa |
| Protein Interactions | NEDD8; UBC; TRAPPC3L; TRAPPC11; TRAPPC12; TRAPPC3; TRAPPC10; |