Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> PRPF19 (Pre-mRNA-processing Factor 19, PRP19, Nuclear Matrix Protein 200, NMP200, PRP19/PSO4 Homolog, PSO4, hPso4, Senescence Evasion Factor, SNEV, UBOX4) (FITC)

PRPF19 (Pre-mRNA-processing Factor 19, PRP19, Nuclear Matrix Protein 200, NMP200, PRP19/PSO4 Homolog, PSO4, hPso4, Senescence Evasion Factor, SNEV, UBOX4) (FITC)

Imprimer Imprimer
Identifiez-vous

Référence 131877-FITC-100ul

Conditionnement : 100ul

Marque : US Biological

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

131877-FITCPRPF19 (Pre-mRNA-processing Factor 19, PRP19, Nuclear Matrix Protein 200, NMP200, PRP19/PSO4 Homolog, PSO4, hPso4, Senescence Evasion Factor, SNEV, UBOX4) (FITC)

Specifications
Clone TypeMonoclonal
Hostmouse
Sourcehuman
IsotypeIgG2a,k
GradeAffinity Purified
ApplicationsFLISA WB
CrossreactivityHu Mo Rt
Accession #NM_014502, NP_055317
Shipping TempBlue Ice
Storage Temp-20°C

PSO4 is the human homolog of yeast Pso4, a gene essential for cell survival and DNA repair (Beck et al., 2008 [PubMed 18263876]).[supplied by OMIM]

Applications:
Suitable for use in FLISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSF*

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Applications
Product Type: Mab|Isotype: IgG2a,k|Clone No: 2E5|Host: mouse|Source: human|Concentration: As Reported|Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).|Purity: Purified by Protein A affinity chromatography.|Immunogen: Partial recombinant corresponding to aa1-91 from human PRPF19 (NP_055317) with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes human PRPF19. Species Crossreactivity: mouse and rat.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Partial recombinant corresponding to aa1-91 from human PRPF19 (NP_055317) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human PRPF19. Species Crossreactivity: mouse and rat.