PRPF19 (Pre-mRNA-processing Factor 19, PRP19, Nuclear Matrix Protein 200, NMP200, PRP19/PSO4 Homolog, PSO4, hPso4, Senescence Evasion Factor, SNEV, UBOX4) (FITC)
Cat# 131877-FITC-100ul
Size : 100ul
Brand : US Biological
Contact local distributor :
Phone : +1 850 650 7790
131877-FITCPRPF19 (Pre-mRNA-processing Factor 19, PRP19, Nuclear Matrix Protein 200, NMP200, PRP19/PSO4 Homolog, PSO4, hPso4, Senescence Evasion Factor, SNEV, UBOX4) (FITC)
Specifications
PSO4 is the human homolog of yeast Pso4, a gene essential for cell survival and DNA repair (Beck et al., 2008 [PubMed 18263876]).[supplied by OMIM]
Applications:
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution:
Optimal dilutions to be determined by the researcher.
AA Sequence:
MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSF*
Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.