AKT1 antibody - N-terminal region (AVARP06008_T100)
Cat# AVARP06008_T100
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
AKT1 Antibody - N-terminal region (AVARP06008_T100)
| Datasheets/Manuals | Printable datasheet for anti-AKT1 (AVARP06008_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Pig, Sheep |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AKT1 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 100%; Goat: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Sheep: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEK |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-AKT1 (AVARP06008_T100) antibody is Catalog # AAP30466 (Previous Catalog # AAPP01102) |
| Reference | Jones, P.F., et al., (1991) Proc. Natl. Acad. Sci. U.S.A. 88: 4171-4175. |
|---|---|
| Gene Symbol | AKT1 |
| Gene Full Name | V-akt murine thymoma viral oncogene homolog 1 |
| Alias Symbols | AKT, PKB, RAC, PRKBA, PKB-ALPHA, RAC-ALPHA |
| NCBI Gene Id | 207 |
| Protein Name | RAC-alpha serine/threonine-protein kinase |
| Description of Target | AKT1 is a general protein kinase capable of phosphorylating several known proteins. |
| Uniprot ID | P31749 |
| Protein Accession # | NP_005154 |
| Nucleotide Accession # | NM_005163 |
| Protein Size (# AA) | 480 |
| Molecular Weight | 56kDa |
