| Product name | ARO-A13627-100 |
|---|---|
| Uniprot ID | Q9NQI0 |
| Raw Antigen Sequence | NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRG |
| Buffer | 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300. |
| Delivery condition | Blue ice (+4°C) |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt. |
| Host species | Rabbit |
| Aliases /Synonyms | Anti-DDX4,VASA,Vasa homolog,DEAD box protein 4,Probable ATP-dependent RNA helicase DDX4, |
| Reference | ARO-A13627 |
| Isotype | IgG |
| Clonality | Polyclonal Antibody |
| Protein Name | E. coli - derived recombinant Human DDX4 (Asn35-Gly131). |