AP2B1 Antibody - middle region - HRP
Cat# ARP53578_P050-HRP
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
AP2B1 Antibody - middle region : HRP (ARP53578_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-AP2B1 (ARP53578_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AP2B1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: DMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-AP2B1 (ARP53578_P050-HRP) antibody is Catalog # AAP53578 (Previous Catalog # AAPS32906) |
| Sample Type Confirmation | AP2B1 is supported by BioGPS gene expression data to be expressed in OVCAR3 |
| Subunit | beta |
| Reference | Schmid,E.M., PLoS Biol. 4 (9), E262 (2006) |
|---|---|
| Gene Symbol | AP2B1 |
| Gene Full Name | Adaptor-related protein complex 2, beta 1 subunit |
| Alias Symbols | ADTB2, AP105B, CLAPB1, AP2-BETA |
| NCBI Gene Id | 163 |
| Protein Name | AP-2 complex subunit beta |
| Description of Target | AP2B1 is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. AP2B1 is found on the cytoplasmic face of coated vesicles in the plasma membrane.The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene. |
| Uniprot ID | P63010-2 |
| Protein Accession # | NP_001025177 |
| Nucleotide Accession # | NM_001030006 |
| Protein Size (# AA) | 951 |
| Molecular Weight | 105kDa |
| Protein Interactions | NEU4; XRCC6BP1; THAP1; U2AF1; KPNA2; SLC25A6; AFF4; TXN2; PIP5K1C; RAPGEF3; AP1M2; SUMO2; GTF2I; UBC; EGFR; SUMO1; NEDD8; EPHA2; RPA3; RPA2; RPA1; SEC24C; NUSAP1; EPN1; XPO7; PLOD2; LNPEP; GRB2; LDLRAP1; AP2M1; UBD; RNF11; MMS19; ITGA4; FN1; ERBB2; DAB2; |
