The immunogen for anti-BCAM antibody: synthetic peptide directed towards the C terminal of human BCAM. Synthetic peptide located within the following region: ADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLT
Buffer
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Lutheran blood group glycoprotein is a member of the immunoglobulin superfamily and a receptor for the extracellular matrix protein, laminin. This protein may play a role in epithelial cell cancer and in vaso-occlusion of red blood cells in sickle cell disease.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
You might also be interested by the following products:
