| Product name | Fibroblast Growth Factor proteins 21(FGF21)(29-209) |
|---|---|
| Uniprot ID | Q9NSA1 |
| Uniprot link | https://www.uniprot.org/uniprot/Q9NSA1 |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
| Molecular weight | 20.61kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | His29-Ser209 |
| Protein Accession | Q9NSA1 |
| Spec:Entrez GeneID | 26291 |
| Spec:SwissProtID | Q8N683 |
| NCBI Reference | Q9NSA1 |
| Aliases /Synonyms | FGF-21 |
| Reference | PX-P4734 |
| Note | For research use only |
| Molecular Constructor | His His29–Ser209 |