HBZ
Cat# ARP42231_T100
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
HBZ Antibody - N-terminal region (ARP42231_T100)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-HBZ (ARP42231_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Goat, Horse, Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HBZ |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Goat: 93%; Horse: 86%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 92%; Rat: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-HBZ (ARP42231_T100) antibody is Catalog # AAP42231 (Previous Catalog # AAPP24654) |
| Sample Type Confirmation | HBZ is supported by BioGPS gene expression data to be expressed in K562 |
| Subunit | zeta |
| Reference | Hivin,P., J. Cell. Sci. 118 (PT 7), 1355-1362 (2005) |
|---|---|
| Gene Symbol | HBZ |
| Gene Full Name | Hemoglobin, zeta |
| Alias Symbols | HBAZ, HBZ1, HBZ-T1 |
| NCBI Gene Id | 3050 |
| Protein Name | Hemoglobin subunit zeta |
| Description of Target | Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'.Zeta-globin (HBZ ) is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that involves 4 functional genes and 3 nonfunctional pseudogenes. The order of genes is: 5'-zeta -- pseudozeta -- pseudoalpha2 -- pseudoalpha1 -- alpha2 -- alph1 -- theta1-3'. |
| Uniprot ID | P02008 |
| Protein Accession # | NP_005323 |
| Nucleotide Accession # | NM_005332 |
| Protein Size (# AA) | 142 |
| Molecular Weight | 16kDa |
| Protein Interactions | NOTCH2NL; KRTAP10-3; KRTAP10-9; KRTAP10-7; KHDRBS2; KRT40; DOCK8; HBD; UPF2; HNRNPD; VCAM1; ITGA4; FN1; APP; SP1; JUND; IKBKG; HBZ; HBB; FGFR3; |
