Human CD85j-LILRB1 recombinant protein

Cat# NB-21-26313

Size : 100ug

Brand : Neo Biotech

Contact local distributor :


Phone : +1 850 650 7790

Human CD85j-LILRB1 recombinant protein

Product name Human CD85j-LILRB1 recombinant protein
Uniprot ID Q8NHL6
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRH
Molecular weight 50.59 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Mammalian cells
Fragment Type Met1-His458
Aliases /Synonyms LIR1, Immunoglobulin-like transcript 2, MIR7, CD85 antigen-like family member J, Monocyte/macrophage immunoglobulin-like receptor 7, ILT-2, Leukocyte immunoglobulin-like receptor subfamily B member 1, LIR-1, CD85j, ILT2, LILRB1, MIR-7, Leukocyte immunoglobulin-like receptor 1
Reference PX-P6220
Note For research use only
Molecular Constructor
Met1–His458 His