mouse Anti-KIT (v-kit Hardy-Zuckerman 4 feline Sarcoma Viral Oncogene Homolog, C-Kit, CD117, PBT, SCFR) (PE) Monoclonal Antibody [Clone:4F19]
Cat# 247925-PE-100ul
Size : 100ul
Brand : US Biological
247925-PE KIT (v-kit Hardy-Zuckerman 4 feline Sarcoma Viral Oncogene Homolog, C-Kit, CD117, PBT, SCFR) (PE)
Clone Type
MonoclonalHost
mouseIsotype
IgG2b,kGrade
PurifiedApplications
FLISA WBAccession #
NP_000213Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeThis gene encodes the human homolog of the proto-oncogene c-kit. C-kit was first identified as the cellular homolog of the feline sarcoma viral oncogene v-kit. This protein is a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cell factor). Mutations in this gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous lukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Applications:
Suitable for use in FLISA, Western Blot. Other applications not tested.
Recommended Dilution:
Optimal dilutions to be determined by the researcher.
AA Sequence:
PGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTD
Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.

