Outer Membrane Protein C, Recombinant E. coli, aa22-367, His-Tag (ompC)
Cat# 518038-100ug
Size : 100ug
Brand : US Biological
518038 Outer Membrane Protein C, Recombinant E. coli, aa22-367, His-Tag (ompC)
Swiss Prot
P06996Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CForms pores that allow passive diffusion of small molecules across the outer membrane.
Source:
Recombinant protein corresponding to aa22-367 of E. coli Outer Membrane Protein C, fused to 6xHis-Tag at N-terminal, expressed in E. coli.
Molecular Weight:
~42.3kD
Amino Acid Sequence:
AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

