POU5F1 Protein, Human, Recombinant (B2M & His)
Cat# NB-64-50569-20ug
Size : 20ug
Brand : Neo Biotech
Remove All
POU5F1 Protein, Human, Recombinant (B2M & His)
(Synonyms: transcription factor 1, POU5F1, POU domain, class 5, transcription factor 1, OTF3, Octamer-binding transcription factor 3 (OTF-3), Octamer-binding protein 4 (Oct-4), Octamer-binding protein 3 (Oct-3), class 5) Copy Product InfoSynonyms: transcription factor 1, POU5F1, POU domain, class 5, transcription factor 1, OTF3, Octamer-binding transcription factor 3 (OTF-3), Octamer-binding protein 4 (Oct-4), Octamer-binding protein 3 (Oct-3), class 5
Catalog No. TMPH-01895 Copy Product Info
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 or SOX15 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency. POU5F1 Protein, Human, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 52.6 kDa and the accession number is Q01860.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 or SOX15 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency. POU5F1 Protein, Human, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 52.6 kDa and the accession number is Q01860. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-6xHis-B2M |
| Accession Number | Q01860 |
| Amino Acid | MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN |
| Construction | 1-360 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | transcription factor 1, POU5F1, POU domain, class 5, transcription factor 1, OTF3, Octamer-binding transcription factor 3 (OTF-3), Octamer-binding protein 4 (Oct-4), Octamer-binding protein 3 (Oct-3), class 5 |
| Research Background | Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 or SOX15 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency. |
| Molecular Weight | 52.6 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
POU5F 1OTF-3OTF 3class54593445933
Related Tags: POU5F1 Protein, Human, Recombinant (B2M & His) chemical structure | POU5F1 Protein, Human, Recombinant (B2M & His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

