Recombinant Hantaan virus Envelope glycoprotein(GP)

Cat# orb2924309-20ug

Size : 20ug

Brand : Biorbyt

Contact local distributor :


Phone : +1 850 650 7790

Recombinant Hantaan virus Envelope glycoprotein(GP)

SKU: orb2924309

Description

This Recombinant Hantaan virus Envelope glycoprotein(GP) spans the amino acid sequence from region 649-1134.

Research Area

Infectious Disease & Virology

Images & Validation

Key Properties

Biological OriginHantaan virus (strain Hojo) (Hojo virus) (Korean hemorrhagic fever virus)
Expression Region649-1134
Protein Lengthfull length protein
Protein SequenceSETPLTPVWNDNAHGVGSIPMHTDLELDFSLTSSSKYTYRRKLTNPLEAQSIDLHIEIEE QTIGVDVHALGHWFDGRLNLKTSFHCYGACTKYEYPWHTAKCHYERDYQYETSWGCNPSD CPGCGTGCTACGLYLDRLKPVGSAYKIITIRYSRRVCVQFGEENLCKIIDMNDCFVSRHV KVCIIGTVSKFSQGDTLLFFGPLEGGGLIFKHWRTSTCQFGDPGDIMSPRDKGFLCPEFP GSFRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQSFNTSTMHFTDERIEWKDPDGMLR DHINILVTKDIDFDNLGENPCKIGLQTSSIEGAWGSGVGFTLTCLVSLTECPTFLTSIKA CDKAICYGAESVTLTRGQNTVKVSGKGGHSGSTFKCCHGEDCSPNGLHAAAPHLDKVNGI SEIENSKEYDDGAPQCGIKCWFVKSGEWISGIFSGNWIVLIVLCVFLLFSLVLLSILCPV RKHKKS

Storage & Handling

StorageStorage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Form/AppearanceLyophilized powder
Buffer/PreservativesTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Envelope glycoprotein, GP, M polyprotein, Cleaved into the following 2 chains:, 1. Glycoprotein G1, 2. Glycoprotein G2

UniProt Details

No UniProt data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide