Biovalley > Recombinant human C-C motif chemokine 22
Recombinant human C-C motif chemokine 22
Brand : Aviva Systems Biology
CCL22 Recombinant Protein (Human) (OPCA00608)
| Datasheets/Manuals | Printable datasheet for CCL22 Recombinant Protein (Human) (OPCA00608) |
|---|
| Predicted Species Reactivity | Homo sapiens|Human |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Additional Information | Tag information : GST tag |
| Reconstitution and Storage | -20°C or -80°C |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVP |
| Protein Sequence | GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVP |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 25-82 aa |
| Tag | N-terminal GST-tagged |
| Reference | Livingston R.J., Shaffer T., McFarland I., Nguyen C.P., Stanaway I.B., Rajkumar N., Johnson E.J., da Ponte S.H., Willa H., Ahearn M.O., Bertucci C., Acklestad J., Carroll A., Swanson J., Gildersleeve H.I., Nickerson D.A.Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) |
|---|---|
| Gene Symbol | CCL22 |
| Gene Full Name | C-C motif chemokine ligand 22 |
| Alias Symbols | A-152E5.1, ABCD-1, C-C motif chemokine 22, CC chemokine STCP-1, chemokine (C-C motif) ligand 22, DC/B-CK, macrophage-derived chemokine, MDC, MDC(1-69), SCYA22, small inducible cytokine A22, small inducible cytokine subfamily A (Cys-Cys), member 22, Small-inducible cytokine A22, STCP-1, stimulated T cell chemotactic protein 1, Stimulated T-cell chemotactic protein 1. |
| NCBI Gene Id | 6367 |
| Protein Name | C-C motif chemokine 22 |
| Description of Target | May play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Chemotactic for monocytes, dendritic cells and natural killer cells. Mild chemoattractant for primary activated T-lymphocytes and a potent chemoattractant for chronically activated T-lymphocytes but has no chemoattractant activity for neutrophils, eosinophils, and resting T-lymphocytes. Binds to CCR4. Processed forms MDC(3-69), MDC(5-69) and MDC(7-69) seem not be active. |
| Uniprot ID | O00626 |
| Protein Size (# AA) | Partial |
| Molecular Weight | 33.7 kDa |
Protein interactions
| Name | # of Products |
|---|---|
| CCL19 | 22 |
| CCR4 | 33 |
| DPP4 | 131 |
| VCAM1 | 51 |
Biological pathways
| Name | # of Products |
|---|---|
| Cell-cell signaling | 763 |
| Chemotaxis | 300 |
| Immune response | 1416 |
| Inflammatory response | 911 |
| Response to virus | 401 |
| Signal transduction | 939 |
Biological process
| Name | # of Products |
|---|---|
| Cell-cell signaling | 235 |
| Chemotaxis | 142 |
| Immune response | 404 |
| Inflammatory response | 339 |
| Response to virus | 137 |
| Signal transduction | 1058 |
Cellular components
| Name | # of Products |
|---|---|
| Extracellular region | 1573 |
| Extracellular space | 884 |
Protein function
| Name | # of Products |
|---|---|
| Chemokine activity | 273 |
-
Rabbit anti-human C-C motif chemokine 22 (OACA01271)Catalog #: OACA01271Conjugation: UnconjugatedApplication: ELISA, WBFormat: Liquid -
CCL22 Antibody - HRP Conjugated (OACA01272)Catalog #: OACA01272Conjugation: HRPApplication: ELISAFormat: Liquid -

-

-
MDC ELISA Kit (Human) : 96 Wells (OKAG00203)Catalog #: OKAG00203Application: ELISA-SandwichKit Range: 8-500 pg/mLSensitivity: 8 pg/mLFormat: 1 x 96-Well Plate or 12 x 8-Well Strips


