Recombinant Human IL-1 beta (His, Strep)

Cat# PH1025-500ug

Size : 500ug

Brand : APExBIO Technology

Contact local distributor :


Phone : +1 850 650 7790

Recombinant Human IL-1 beta (His, Strep)

Catalog No.
PH1025
Recombinant Human IL-1β (HEK293, C-His & C-Strep, Liquid)

Background

Interleukin 1β (IL1β or IL1B), also known as catabolin, is a member of the interleukin 1 family of cytokines. IL1 refers to two pleiotropic cytokines, IL-1α (IL-1F1) and IL-1β (IL-1F2), which are products of different genes. IL-1α and IL-1β are structurally related peptides that share about 21% amino acid (aa) identity in humans. Both proteins are produced by a wide variety of cells in response to inflammatory factors, infections, or microbial endotoxins. While IL-1α and IL-1β are independently regulated, they bind to the same receptor and exert the same biological role. IL-1RI binds directly to IL-1α or IL-1β and then to the IL-1R accessory protein (IL-1R3/IL-1RAcP) to form a high-affinity receptor complex capable of signal transduction. IL-1RII has a high affinity for IL-1β but acts as a decoy receptor and a negative regulator of IL-1β activity. Human IL-1β cDNA encodes a precursor of 269 amino acids. The cysteine protease IL-1β convertase (Caspase-1/ICE) cleaves the 116aa propeptide intracellularly to produce active cytokines [5-7]. The 17 kDa mature human IL-1β has 96% aa sequence homology with rhesus macaques and 67%-78% aa sequence homology with dogs, cotton mice, horses, cats, mice, pigs, and rats.

Description

Gene ID

3553

Accession #

P01584

Alternate Names

Human IL1 beta; IL-1 beta; IL-1; IL-1b; IL1-BETA; IL-1F2; IL-1 beta; interleukin-1 beta

Source

HEK293

Protein sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Tag

C-His, C-Strep

M.Wt

The protein has a calculated MW of 17.4 kDa.

Appearance

Solution protein.

Stability & Storage

Avoid repeated freeze-thaw cycles. It is recommended that the protein be aliquoted for optimal storage.
2 years from date of receipt, -20 to -70°C as supplied.

Concentration

1 mg/mL

Formulation

Supplied as a 0.2 μm filtered solution in PBS, pH7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. This solution can be diluted into other aqueous buffers.

Biological Activity

Testing in progress.

Shipping Condition

Shipping with dry ice.

Handling

Centrifuge the vial prior to opening.

Usage

For Research Use Only! Not to be used in humans.

Quality Control

Quality Control & DataSheet

View current batch:
    Purity > 95 % by SDS-PAGE.
    Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
  • Datasheet