Recombinant Human Trifunctional Purine  Biosynthetic Protein Adenosine-3, aa111-318, His-Tag

Cat# 586134-20ug

Size : 20ug

Brand : US Biological

Contact local distributor :


Phone : +1 850 650 7790


586134 Recombinant Human Trifunctional Purine |Biosynthetic Protein Adenosine-3, aa111-318, His-Tag

Swiss Prot
P22102
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Source:
Recombinant protein corresponding to aa111-318 from human Trifunctional purine biosynthetic protein adenosine-3, fused to 6X His-Tag at N-terminal, expressed in E.coli.

Molecular Weight:
~26.5kD

Amino Acid Sequence:
KEFMDRHGIPTAQWKAFTKPEEACSFILSADFPALVVKASGLAAGKGVIVAKSKEEACKAVQEIMQEKAFGAAGETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYCPAPQVSNDLLLKIKDTVLQRTVDGMQQEGTPYTGILYAGIMLTKNGPKVLEFNCRFGDPECQVILPLLKSDLYEVIQSTLD

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ≥85% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity
≥85% (SDS-PAGE)