RpsR, Recombinant, E. coli, aa2-75, GST-Tag (30S Ribosomal Protein S18)
Cat# 375156-100ug
Size : 100ug
Brand : US Biological
Contact local distributor :
Phone : +1 850 650 7790
375156RpsR, Recombinant, E. coli, aa2-75, GST-Tag (30S Ribosomal Protein S18)
Specifications
Swiss ProtP0A7T7
GradePurified
Shipping TempBlue Ice
Storage Temp-20°C
Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit.
Source:
Recombinant protein corresponding to aa2-75 from E. coli rpsR, fused to GST-Tag at N-terminal, expressed in E. coli.
Molecular Weight:
~35.9kD
Amino Acid Sequence:
ARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPYTDRHQ
Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Applications
Source: Recombinant, E. coli|Purity: ≥90% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity
≥90% (SDS-PAGE)
References
1. Study of the structural dynamics of the E. coli 70S ribosome using real-space refinement. Gao H., Sengupta J., Valle M., Korostelev A., Eswar N., Stagg S.M., Van Roey P., Agrawal R.K., Harvey S.C., Sali A., Chapman M.S., Frank J.Cell 113:789-801(2003).