Sulfotransferase 4A1 (ST4A1, SULT4A1, Brain Sulfotransferase-like Protein, BRSTL1, BR-STL-1, hBR-STL, hBR-STL-1, Nervous System Sulfotransferase, NST, SULTX3, DJ388M5.3) (FITC)
Cat# 134087-FITC-100ul
Size : 100ul
Brand : US Biological
Contact local distributor :
Phone : +1 850 650 7790
134087-FITC Sulfotransferase 4A1 (ST4A1, SULT4A1, Brain Sulfotransferase-like Protein, BRSTL1, BR-STL-1, hBR-STL, hBR-STL-1, Nervous System Sulfotransferase, NST, SULTX3, DJ388M5.3) (FITC)
Clone Type
MonoclonalHost
mouseSource
humanIsotype
IgG2a,kGrade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_014351Shipping Temp
Blue IceStorage Temp
-20°C
Applications:
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution:
FLISA: 1ng/ml
Optimal dilutions to be determined by the researcher.
AA Sequence:
MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIK*
Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.