Alx3 Antibody - middle region - HRP

Cat# ARP32532_P050-HRP

Size : 100ul

Brand : Aviva Systems Biology

Contact local distributor :


Phone : +1 850 650 7790

Alx3 Antibody - middle region : HRP (ARP32532_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-Alx3 (ARP32532_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Rat Alx3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: FPACGPLEPYLPEPAKPPAKYLQDLGPGPVLNGGHFYEGSSEAEEKASKA
Concentration0.5 mg/ml
Blocking PeptideFor anti-Alx3 (ARP32532_P050-HRP) antibody is Catalog # AAP32532
Gene SymbolAlx3
Alias Symbols-
NCBI Gene Id365900
Protein NameAristaless-related ALX3 EMBL AAR37014.1
Description of TargetThe function of this protein remains unknown.
Uniprot IDQ6RW14
Protein Accession #NP_001007013
Nucleotide Accession #NM_001007012
Protein Size (# AA)343
Molecular Weight37kDa