AMBP Antibody - N-terminal region - Biotin
Cat# ARP59163_P050-Biotin
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
AMBP Antibody - N-terminal region : Biotin (ARP59163_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-AMBP (ARP59163_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AMBP |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 83%; Guinea Pig: 85%; Horse: 79%; Human: 100%; Pig: 92%; Rabbit: 93%; Rat: 79% |
| Peptide Sequence | Synthetic peptide located within the following region: VCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFS |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-AMBP (ARP59163_P050-Biotin) antibody is Catalog # AAP59163 (Previous Catalog # AAPP45133) |
| Sample Type Confirmation | AMBP is supported by BioGPS gene expression data to be expressed in 721_B, HepG2 |
| Gene Symbol | AMBP |
|---|---|
| Gene Full Name | Alpha-1-microglobulin/bikunin precursor |
| Alias Symbols | A1M, HCP, ITI, UTI, EDC1, HI30, ITIL, IATIL, ITILC |
| NCBI Gene Id | 259 |
| Protein Name | Protein AMBP |
| Description of Target | This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes. |
| Uniprot ID | P02760 |
| Protein Accession # | NP_001624 |
| Nucleotide Accession # | NM_001633 |
| Protein Size (# AA) | 352 |
| Molecular Weight | 39kDa |
| Protein Interactions | FHL3; DAAM1; STAT3; ENO1; COX8A; PIK3R3; PIK3CA; GRB2; F2; AMBP; FN1; A2M; ALB; CD79A; |
