AMH Antibody - middle region - Biotin
Cat# ARP54312_P050-Biotin
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
AMH Antibody - middle region : Biotin (ARP54312_P050-Biotin)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-AMH (ARP54312_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Sheep |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | IHC, WB |
| Additional Information | IHC Information: Western analysis of fetal small intestine lysate. |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AMH |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-AMH (ARP54312_P050-Biotin) antibody is Catalog # AAP54312 (Previous Catalog # AAPP31061) |
| Reference | Rohr,J., (2008) Hum. Reprod. 23 (5), 1220-1225 |
|---|---|
| Gene Symbol | AMH |
| Gene Full Name | Anti-Mullerian hormone |
| Alias Symbols | MIF, MIS |
| NCBI Gene Id | 268 |
| Protein Name | Muellerian-inhibiting factor |
| Description of Target | Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome.Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | Q6GTN3 |
| Protein Accession # | NP_000470 |
| Nucleotide Accession # | NM_000479 |
| Protein Size (# AA) | 560 |
| Molecular Weight | 60kDa |
| Protein Interactions | ZMAT2; ARL8B; ETV5; COPS5; PCSK5; AMHR2; EGFR; |
