ANGPTL3 Antibody - N-terminal region
Cat# ARP42411_P050-25UL
Size : 25ul
Brand : Aviva Systems Biology
ANGPTL3 Antibody - N-terminal region (ARP42411_P050)
| Datasheets/Manuals | Printable datasheet for anti-ANGPTL3 (ARP42411_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ANGPTL3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: VKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ANGPTL3 (ARP42411_P050) antibody is Catalog # AAP42411 (Previous Catalog # AAPP24757) |
| Gene Symbol | ANGPTL3 |
|---|---|
| Gene Full Name | Angiopoietin-like 3 |
| Alias Symbols | ANL3, ANG-5, FHBL2, ANGPT5 |
| NCBI Gene Id | 27329 |
| Protein Name | Angiopoietin-related protein 3 |
| Description of Target | The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors. It is predominantly expressed in the liver, and has the characteristic structure of angiopoietins, consisting of a signal peptide, N-terminal coiled-coil domain and the C-terminal fibrinogen (FBN)-like domain. The FBN-like domain in angiopoietin-like 3 protein was shown to bind alpha-5/beta-3 integrins, and this binding induced endothelial cell adhesion and migration. This protein may also play a role in the regulation of angiogenesis. |
| Uniprot ID | Q9Y5C1 |
| Protein Accession # | NP_055310 |
| Nucleotide Accession # | NM_014495 |
| Protein Size (# AA) | 460 |
| Molecular Weight | 51kDa |
| Protein Interactions | UBC; ITGAV; ITGB3; ITGA5; |






