Anti-DDX4 Polyclonal antibody

Cat# NB-21-36375

Size : 100µg

Brand : Neo Biotech

Contact local distributor :


Phone : +1 850 650 7790

Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Specifications Anti-DDX4 Polyclonal antibody

Product name ARO-A13627-100
Uniprot ID Q9NQI0
Raw Antigen Sequence NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRG
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-DDX4,VASA,Vasa homolog,DEAD box protein 4,Probable ATP-dependent RNA helicase DDX4,
Reference ARO-A13627
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human DDX4 (Asn35-Gly131).
Product name ARO-A13627-1MG
Uniprot ID Q9NQI0
Raw Antigen Sequence NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRG
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-DDX4,VASA,Vasa homolog,DEAD box protein 4,Probable ATP-dependent RNA helicase DDX4,
Reference ARO-A13627
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human DDX4 (Asn35-Gly131).
Product name ARO-A13627-50
Uniprot ID Q9NQI0
Raw Antigen Sequence NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRG
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-DDX4,VASA,Vasa homolog,DEAD box protein 4,Probable ATP-dependent RNA helicase DDX4,
Reference ARO-A13627
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human DDX4 (Asn35-Gly131).

Documents

QC & Validation

Anti-DDX4 Polyclonal antibody binds to Recombinant Human DDX4, N-His in WB Assay

Anti-DDX4 Polyclonal antibody binds to Recombinant Human DDX4, N-His in WB Assay

Recombinant Human DDX4, N-His(cat. No.ARO-P13069) can bind Anti-DDX4 Polyclonal antibody in Western Blot Assay as detected on gel analysis.

3D Representation

Anti-DDX4 Polyclonal antibody

Reviews

There are no reviews yet.

Be the first to review “Anti-DDX4 Polyclonal antibody” Cancel reply

Related products

  • Recombinant Human DDX4, N-His

    ARO-P13069

    Recombinant Human DDX4, N-His