Anti-Mouse NODAL Polyclonal Antibody

Cat# NB-21-38778

Size : 100µg

Brand : Neo Biotech

Contact local distributor :


Phone : +1 850 650 7790

Anti-Mouse NODAL Polyclonal Antibody

Product name ARO-A11054-100
Uniprot ID P43021
Raw Antigen Sequence SPLAYMLSLYRDPLPRADIIRSLQAQDVDVTGQNWTFTFDFSFLSQEEDLVWAELRLQLPGPMDIPTEGPLTIDIFHQAKGDPERDPADCLERIWMETFTVIPSQVTFASGSTVLEVTKPLSKWLKDPRALEKQVSSRAEKCWHQPYTPPVPVASTNVLMLYSN
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Host species Rabbit
Aliases /Synonyms Anti-Nodal
Reference ARO-A11054
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Mouse NODAL (Ser40-Asn203).