Bloc1s2 Antibody - N-terminal region - HRP
Cat# ARP55703_P050-HRP
Size : 100ul
Brand : Aviva Systems Biology
Bloc1s2 Antibody - N-terminal region : HRP (ARP55703_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-Bloc1s2 (ARP55703_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Peptide Sequence | Synthetic peptide located within the following region: KEPAEADINELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLE |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Bloc1s2 (ARP55703_P050-HRP) antibody is Catalog # AAP55703 |
| Subunit | 2 |
| Gene Symbol | Bloc1s2 |
|---|---|
| Gene Full Name | Biogenesis of lysosome-related organelles complex-1, subunit 2 |
| Alias Symbols | BL, Bloc, BLOS2, Bloc1s2a, 2410089B13Rik |
| NCBI Gene Id | 73689 |
| Protein Name | Biogenesis of lysosome-related organelles complex 1 subunit 2 |
| Description of Target | Bloc1s2 may play a role in cell proliferation. The BLOC-1 complex is required for normal biogenesis of lysosome-related organelles, such as platelet dense granules and melanosomes. It plays a role in intracellular vesicle trafficking. |
| Uniprot ID | Q9CWG9 |
| Protein Accession # | NP_082883 |
| Nucleotide Accession # | NM_028607 |
| Protein Size (# AA) | 143 |
| Molecular Weight | 15kDa |




