Reagents and instruments for immunology, cell biology and molecular biology.
 
> CD81 Recombinant Protein

CD81 Recombinant Protein

Print Print
Please log in

Cat# NB-21-24434

Size : 100ug

Brand : Neo Biotech

Contact local distributor :


Phone : +1 850 650 7790

CD81 Recombinant Protein

Product name PX-P4091-100
Uniprot ID P60033
Uniprot link http://www.uniprot.org/uniprot/P60033
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular weight 10.59kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Host species Escherichia coli (E.coli)
Fragment Type Phe113~Lys201
Aliases /Synonyms TAPA1, TSPAN28
Reference PX-P4091
Note For research use only
Molecular Constructor
His Phe113~Lys201