EGFP Protein - Enhanced green fluorescent protein(egfp)

Print

Size : 100ug

Phone : +1 850 650 7790

Request more information

Phone : +1 850 650 7790

Product name	PX-P4577-1MG
Uniprot ID	C5MKY7
Uniprot link	https://www.uniprot.org/uniprot/C5MKY7
Origin species	Human cytomegalovirus (HHV-5) (Human herpesvirus 5)
Expression system	Prokaryotic expression
Raw Antigen Sequence	MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Molecular weight	32kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH 7.5
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species	Escherichia coli (E.coli)
Fragment Type	Met1-Lys239
Protein Accession	C5MKY7
NCBI Reference	AAK15492
Reference	PX-P4577
Note	For research use only.
Molecular Constructor	Met1–Lys239 His

Specifications EGFP Protein - Enhanced green fluorescent protein(egfp)