FAM107A Antibody - N-terminal region
Cat# ARP42347_P050-25UL
Size : 25ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
FAM107A Antibody - N-terminal region (ARP42347_P050)
| Datasheets/Manuals | Printable datasheet for anti-FAM107A (ARP42347_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM107A |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: IQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMN |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-FAM107A (ARP42347_P050) antibody is Catalog # AAP42347 |
| Gene Symbol | FAM107A |
|---|---|
| Gene Full Name | family with sequence similarity 107, member A |
| Alias Symbols | DRR1, TU3A |
| NCBI Gene Id | 11170 |
| Protein Name | Protein FAM107A |
| Description of Target | When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development. |
| Uniprot ID | O95990 |
| Protein Accession # | NP_009108 |
| Nucleotide Accession # | NM_007177 |
| Protein Size (# AA) | 144 |
| Molecular Weight | 17kDa |
| Protein Interactions | KRT40; FSD2; LZTS2; USHBP1; CCDC136; RINT1; MID2; PNMA1; TRIM37; CCDC85B; WDR47; KRTAP4-12; NINL; HOOK2; CALCOCO2; BEGAIN; EFEMP2; TADA2A; TRAF2; LDOC1; VIM; KRT15; KRT19; CANX; DCD; PPP2R2A; |
