Immunofluorescence
Immunofluorescence of monoclonal antibody to TNFSF6 on HeLa cell. [antibody concentration 10 ug/ml]
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MMP7 and FASLG. HeLa cells were stained with anti-MMP7 rabbit purified polyclonal 1:1200 and anti-FASLG mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot (Transfected lysate)
Western Blot analysis of FASLG expression in transfected 293T cell line by FASLG monoclonal antibody (M02), clone 2G9-G8.
Lane 1: FASLG transfected lysate (Predicted MW: 31.5 KDa).
Lane 2: Non-transfected lysate.
- Specifications
Product Description
Mouse monoclonal antibody raised against a full length recombinant FASLG.
Immunogen
FASLG (AAH17502.1, 1 a.a. ~ 281 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Host
Mouse
Reactivity
Human
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Immunofluorescence
Immunofluorescence of monoclonal antibody to TNFSF6 on HeLa cell. [antibody concentration 10 ug/ml]ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MMP7 and FASLG. HeLa cells were stained with anti-MMP7 rabbit purified polyclonal 1:1200 and anti-FASLG mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Western Blot (Transfected lysate)
Western Blot analysis of FASLG expression in transfected 293T cell line by FASLG monoclonal antibody (M02), clone 2G9-G8.
Lane 1: FASLG transfected lysate (Predicted MW: 31.5 KDa).
Lane 2: Non-transfected lysate.
- Gene Info — FASLG
Entrez GeneID
356GeneBank Accession#
BC017502Protein Accession#
AAH17502.1Gene Name
FASLG
Gene Alias
APT1LG1, CD178, CD95L, FASL, TNFSF6
Gene Description
Fas ligand (TNF superfamily, member 6)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is the ligand for FAS. Both are transmembrane proteins. Interaction of FAS with this ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). [provided by RefSeq
Other Designations
CD95 ligand|OTTHUMP00000032708|apoptosis (APO-1) antigen ligand 1|fas ligand|tumor necrosis factor (ligand) superfamily, member 6
- Interactomes
- Pathways
- Diseases
- Literature Request
Cancer Bioreagents