Foxl2 Antibody - C-terminal region - Biotin
Cat# ARP39574_P050-Biotin
Size : 100ul
Brand : Aviva Systems Biology
Foxl2 Antibody - C-terminal region : Biotin (ARP39574_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-Foxl2 (ARP39574_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Goat, Horse, Pig, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Rat |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Goat: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: SPATAAPPAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALHSRLD |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Foxl2 (ARP39574_P050-Biotin) antibody is Catalog # AAP39574 (Previous Catalog # AAPP21587) |
| Gene Symbol | Foxl2 |
|---|---|
| Gene Full Name | Forkhead box L2 |
| Alias Symbols | Foxl2 |
| NCBI Gene Id | 367152 |
| Protein Name | Protein Foxl2 Ensembl ENSRNOP00000023091 |
| Description of Target | The function of Foxl2 remains unknown. |
| Uniprot ID | D4A0S1 |
| Protein Accession # | XP_001070279 |
| Nucleotide Accession # | XM_001070279 |
| Protein Size (# AA) | 374 |
| Molecular Weight | 39kDa |






