FSH protein - Chinese sturgeon Follicle-stimulating hormone(Follicle) Recombinant Protein

Cat# NB-21-23099

Size : 50ug

Brand : Neo Biotech

Contact local distributor :


Phone : +1 850 650 7790

FSH protein - Chinese sturgeon Follicle-stimulating hormone(Follicle) Recombinant Protein

Product name FSH protein - Chinese sturgeon Follicle-stimulating hormone(Follicle) Recombinant Protein
Uniprot ID B2CKR3
Uniprot link http://www.uniprot.org/uniprot/B2CKR3
Origin species Chinese sturgeon
Expression system Eukaryotic expression
Raw Antigen Sequence MASVLFCFVLLCWAAGQCHASCALENITIGIEKDGCGNCVSVNTTSCAGRCLTQADVYKSSISLYTQLVCTFKEISYVTVQLPNCPEHVDPFYTYPVALSCECGQCATDYTDCGTLSLGPSDCFSQEDDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight 39.85 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference B2CKR3
Aliases /Synonyms Follicle Stimulating Hormone, FSH
Reference PX-P3016
Note For research use only
Molecular Constructor
Full-length Yes