gH Recombinant Protein
Cat# OPCA01992-100UG
Size : 100ug
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
GH Recombinant Protein (HHV-5) (OPCA01992)
| Datasheets/Manuals | Printable datasheet for GH Recombinant Protein (HHV-5) (OPCA01992) |
|---|
| Predicted Species Reactivity | Human cytomegalovirus|Human Herpesvirus 5 |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Human cytomegalovirus |
| Additional Information | Relevance: The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma mbranes leading to virus entry into the host cell. Mbrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL . Fusion of with fibroblasts requires the additional receptor-binding protein gO, which forms a complex with gH/gL. |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | RYGADAASEALDPHAFHLLLNTYGRPIRFLRENTTQCTYNSSLRNSTVVRENAISFNFFQSYNQYYVFHMPRCLFAGPLAEQFLNQVDLTETLERYQQRLNTYALVSKDLASYRSFSQQLKAQDSLGQQPTTVPPPIDLSIPHVWMPPQTTPHDWKGSHTTSGLHRPHFNQT |
| Protein Sequence | RYGADAASEALDPHAFHLLLNTYGRPIRFLRENTTQCTYNSSLRNSTVVRENAISFNFFQSYNQYYVFHMPRCLFAGPLAEQFLNQVDLTETLERYQQRLNTYALVSKDLASYRSFSQQLKAQDSLGQQPTTVPPPIDLSIPHVWMPPQTTPHDWKGSHTTSGLHRPHFNQT |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 24-195 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | ErratumVarnum S.M., Streblow D.N., Monroe M.E., Smith P., Auberry K.J., Pasa-Tolic L., Wang D., Camp D.G. II, Rodland K., Wiley S., Britt W., Shenk T., Smith R.D., Nelson J.A.J. Virol. 78:13395-13395(2004) |
|---|---|
| Gene Symbol | GH |
| Alias Symbols | gH, UL75, Envelope glycoprotein H, gH |
| Protein Name | Envelope glycoprotein H |
| Description of Target | The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Following initial binding to host receptor, membrane fusion is mediated by the fusion machinery composed of gB and the heterodimer gH/gL. May also be involved in the fusion between the virion envelope and the outer nuclear membrane during virion morphogenesis. |
| Uniprot ID | P12824 |
| Protein Size (# AA) | Partial |
| Molecular Weight | 35.8 kDa |
