GNRH1 Antibody
Cat# ARP63800_P050-25UL
Size : 25ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
GNRH1 Antibody (ARP63800_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-GNRH1 (ARP63800_P050) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence CSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 92%; Guinea Pig: 77%; Horse: 86%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 93%; Rat: 92%; Sheep: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: CSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | Available upon request |
| Gene Symbol | GNRH1 |
|---|---|
| Gene Full Name | gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) |
| Alias Symbols | GRH, GNRH, LHRH, LNRH |
| NCBI Gene Id | 2796 |
| Protein Name | Progonadoliberin-1 |
| Description of Target | The protein encoded by this gene is secreted and then cleaved to form the 10 aa luteinizing hormone-releasing hormone (LHRH, also known as gonadoliberin-1), and prolactin release-inhibiting factor (also known as GnRH-associated peptide 1). LHRH stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutation in this gene are associated with hypogonadotropic hypogonadism. Alternatively spliced transcript variants have been described for this gene. |
| Uniprot ID | P01148 |
| Protein Accession # | NP_000816 |
| Nucleotide Accession # | NM_000825 |
| Protein Size (# AA) | 92 |
| Molecular Weight | 10 kDa |
| Protein Interactions | MEP1A; GNRHR; |
