GRXCR2 Antibody - C-terminal region
Cat# ARP70509_P050-25UL
Size : 25ul
Brand : Aviva Systems Biology
GRXCR2 Antibody - C-terminal region (ARP70509_P050)
| Datasheets/Manuals | Printable datasheet for anti-GRXCR2 (ARP70509_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human GRXCR2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Human: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: PLVEAESTLPQNRYTQEGDIPEDSCFHCRGSGSATCSLCHGSKFSMLANR |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-GRXCR2 (ARP70509_P050) antibody is Catalog # AAP70509 |
| Gene Symbol | GRXCR2 |
|---|---|
| Alias Symbols | DFNB101 |
| NCBI Gene Id | 643226 |
| Protein Name | Glutaredoxin domain-containing cysteine-rich protein 2 |
| Description of Target | The function of this protein remains unknown. |
| Uniprot ID | A6NFK2 |
| Protein Accession # | NP_001073985 |
| Nucleotide Accession # | NM_001080516 |
| Protein Size (# AA) | 248 |
| Molecular Weight | 28kDa |


