Biovalley > GTF2H4 Antibody - N-terminal region - Biotin
GTF2H4 Antibody - N-terminal region - Biotin
Brand : Aviva Systems Biology
GTF2H4 Antibody - N-terminal region : Biotin (ARP38046_T100-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-GTF2H4 (ARP38046_T100-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Cow, Dog, Goat, Guinea Pig, Pig |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2H4 |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 87%; Goat: 93%; Guinea Pig: 87%; Human: 100%; Pig: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPS |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-GTF2H4 (ARP38046_T100-Biotin) antibody is Catalog # AAP38046 (Previous Catalog # AAPP20220) |
| Subunit | 4 |
| Reference | Weber,A., (2005) Mol. Cell. Biol. 25 (1), 147-161 |
|---|---|
| Gene Symbol | GTF2H4 |
| Gene Full Name | General transcription factor IIH, polypeptide 4, 52kDa |
| Alias Symbols | P52, TFB2, TFIIH |
| NCBI Gene Id | 2968 |
| Protein Name | General transcription factor IIH subunit 4 |
| Description of Target | GTF2H4 belongs to the TFB2 family. It is a component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. |
| Uniprot ID | Q92759 |
| Protein Accession # | NP_001508 |
| Nucleotide Accession # | NM_001517 |
| Protein Size (# AA) | 462 |
| Molecular Weight | 52kDa |
| Protein Interactions | UBC; CDK7; RNF11; TP53; MNAT1; GTF2H3; GTF2H2; GTF2H1; ERCC3; CCNH; XBP1P1; MYC; GTF2E1; ERCC5; MED21; BTAF1; TBP; POLR2A; GTF2F1; GTF2B; BRCA1; |
-
GTF2H4 Antibody - N-terminal region (ARP38046_T100)Catalog #: ARP38046_T100Species Tested: HumanApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. -
GTF2H4 Antibody - N-terminal region (ARP32598_P050)Catalog #: ARP32598_P050Species Tested: HumanApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. -
GTF2H4 Antibody - N-terminal region (ARP31909_P050)Catalog #: ARP31909_P050Species Tested: Human, MouseApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


