HLA-C Protein, Human, Recombinant (His)
Cat# NB-64-50163-20ug
Size : 20ug
Brand : Neo Biotech
Remove All
HLA-C Protein, Human, Recombinant (His)
(Synonyms: HLA-Cw, HLA-C) Copy Product InfoSynonyms: HLA-Cw, HLA-C
Catalog No. TMPH-01487 Copy Product Info
HLA-C Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 36.7 kDa and the accession number is O78179.
For research use only—not for human use. No sales to individuals. Use as intended only.
Select Batch
Purity:90%(SDS-PAGE)
Appearance:Lyophilized powder
Color:White
Contact us for more batch information
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | HLA-C Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 36.7 kDa and the accession number is O78179. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | O78179 |
| Amino Acid | CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI |
| Construction | 25-308 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | HLA-Cw, HLA-C |
| Research Background | N/A |
| Molecular Weight | 36.7 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Related Tags: HLA-C Protein, Human, Recombinant (His) chemical structure | HLA-C Protein, Human, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote


