Reagents and instruments for immunology, cell biology and molecular biology.
 
> IL13 recombinant protein

IL13 recombinant protein

Print Print
Please log in

Cat# NB-21-25551

Size : 100ug

Brand : Neo Biotech

Contact local distributor :


Phone : +1 850 650 7790
Datasheet

IL13 recombinant protein

Product name PX-P5175-100
Uniprot ID P35225
Uniprot link https://www.uniprot.org/uniprot/P35225
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence PVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
Molecular weight 14.54 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Pro36-Asn146
Protein Accession P35225
Aliases /Synonyms NC30, Interleukin-13
Reference PX-P5175
Note For research use only
Molecular Constructor
His Pro36–Asn146