Reagents and instruments for immunology, cell biology and molecular biology.
 
> Klf4 Peptide - middle region

Klf4 Peptide - middle region

Print Print
Please log in

Cat# orb2010174-100ug

Size : 100ug

Brand : Biorbyt

Contact local distributor :


Phone : +1 850 650 7790

Klf4 Peptide - middle region

SKU: orb2010174
This product can be custom made

Description

Klf4 Peptide - middle region, also known as EZF, Gklf, Zie, is a synthetic peptide designed for use in combination with Klf4 Rabbit Polyclonal Antibody (orb576203). It corresponds to the sequence SPDGSHPVVVAPYSGGPPRMCPKIKQEAVPSCTVSRSLEAHLSAGPQLSN and is supplied in a lyophilized powder. This peptide is for research use only.

Research Area

Cancer Biology

Images & Validation

−
Klf4 Peptide - middle region
Tested ApplicationsWB
Application Notes
This is a synthetic peptide designed for use in combination with Klf4 Rabbit Polyclonal Antibody (orb576203). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

−
Protein SequenceSPDGSHPVVVAPYSGGPPRMCPKIKQEAVPSCTVSRSLEAHLSAGPQLSN

Storage & Handling

−
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

−
EZF, Gklf, Zie
−

Quick Database Links

UniProt
Q60793
RefSeq (Protein):NP_034767

UniProt Details

−
Loading UniProt data...

NCBI Reference Sequences

−
Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_034767

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide
WB
Western Blot (IB, immunoblot)
View Protocol