Lingual antimicrobial peptide Protein, Bubalus bubalis, Recombinant (His & KSI)
Cat# NB-64-48992-200ug
Size : 200ug
Brand : Neo Biotech
Remove All
Lingual antimicrobial peptide Protein, Bubalus bubalis, Recombinant (His & KSI)
(Synonyms: Lingual antimicrobial peptide) Copy Product InfoSynonyms: Lingual antimicrobial peptide
Catalog No. TMPH-00314 Copy Product Info
Has bactericidal activity. Lingual antimicrobial peptide Protein, Bubalus bubalis, Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 19.8 kDa and the accession number is A3RJ36.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Has bactericidal activity. Lingual antimicrobial peptide Protein, Bubalus bubalis, Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 19.8 kDa and the accession number is A3RJ36. |
| Species | Bubalus bubalis |
| Expression System | E. coli |
| Tag | N-6xHis-KSI |
| Accession Number | A3RJ36 |
| Amino Acid | VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK |
| Construction | 25-64 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Lingual antimicrobial peptide |
| Research Background | Has bactericidal activity. |
| Molecular Weight | 19.8 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Related Tags: Lingual antimicrobial peptide Protein, Bubalus bubalis, Recombinant (His & KSI) chemical structure | Lingual antimicrobial peptide Protein, Bubalus bubalis, Recombinant (His & KSI) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

