Major Pollen Allergen Cor a 1, Isoforms 5, 6, 11 and 16, Recombinant, Corylus Avellana, aa2-160, His-SUMO-Tag

Print

Cat# 374126-20ug

Size : 20ug

Contact local distributor :

Phone : +1 850 650 7790

Brand : US Biological

Request more information

Contact local distributor :

Phone : +1 850 650 7790

374126 Major Pollen Allergen Cor a 1, Isoforms 5, 6, 11 and 16, Recombinant, Corylus Avellana, aa2-160, His-SUMO-Tag

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Swiss Prot

Q08407

Grade

Purified

Shipping Temp

Blue Ice

Storage Temp

-20°C

Causes an allergic reaction in human. The Cor a 1 isoforms display different antigenic and allergenic properties.

Source:
Recombinant protein corresponding to aa2-160 from Corylus avellana Major pollen allergen Cor a 1 isoforms 5, 6, 11 and 16, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli.

Molecular Weight:
~33.4kD

Amino Acid Sequence:
GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications

Source: Recombinant, E. coli|Purity: ~90% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

Form

Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.

Purity

~90% (SDS-PAGE)

References

1. "Four recombinant isoforms of Cor a I, the major allergen of hazel pollen, show different IgE-binding properties." Breiteneder H., Ferreira F., Hoffmann-Sommergruber K., Ebner C., Breitenbach M., Rumpold H., Kraft D., Scheiner O.Eur. J. Biochem. 212:355-362(1993).