MGMT Protein - PelB-DN10-ST (virer PelB) Recombinant Protein
Cat# NB-21-24949
Size : 50ug
| Product name | MGMT Protein - PelB-DN10-ST (virer PelB) Recombinant Protein |
|---|---|
| Uniprot ID | P16455 |
| Uniprot link | http://www.uniprot.org/uniprot/P16455 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | MKYLLPTAAAGLLLLAAQPAGSEVQLVESGGGVVQPGDSLRLSCVASGRTDSIYSMAWFRQAPGKEREFVAIITWRREYTNYEDSVRGRFTISRDNAKNAVYLQMNKLKPEDTAVYYCALRPGLRDDLNYWGQGTQVTVSSGGSGGGSGGGSGGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWK |
| Molecular weight | 38.40 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 10% |
| Buffer | PBS, pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Unknown |
| Protein Accession | AFU51890.1 |
| Spec:Entrez GeneID | 4255 |
| Spec:SwissProtID | P16455 |
| NCBI Reference | AFU51890.1 |
| Aliases /Synonyms | PelB-DN10-ST (virer PelB), O-6-methylguanine-DNA methyltransferase |
| Reference | PX-P2087 |
| Note | For research use only |
| Molecular Constructor | Unknown Yes |