PANX2 antibody - N-terminal region
Cat# ARP42778_T100
Size : 100ul
Brand : Aviva Systems Biology
PANX2 Antibody - N-terminal region (ARP42778_T100)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-PANX2 (ARP42778_T100) antibody |
|---|
| Publications | Pannexin 2 is expressed in murine skin and promotes UVB-induced apoptosis of keratinocytes Human stem cells express pannexins Manipulation of Panx1 Activity Increases the Engraftment of Transplanted Lacrimal Gland Epithelial Progenitor Cells |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PANX2 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: GTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDA |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-PANX2 (ARP42778_T100) antibody is Catalog # AAP42778 (Previous Catalog # AAPS10104) |
| Enhanced Validation |
| Reference | Baranova,A., (2004) Genomics 83 (4), 706-716 |
|---|---|
| Gene Symbol | PANX2 |
| Gene Full Name | Pannexin 2 |
| Alias Symbols | PX2, hPANX2 |
| NCBI Gene Id | 56666 |
| Protein Name | Pannexin-2 |
| Description of Target | PANX2 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties.The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties. |
| Uniprot ID | Q96RD6 |
| Protein Accession # | NP_443071 |
| Nucleotide Accession # | NM_052839 |
| Protein Size (# AA) | 633 |
| Molecular Weight | 74 kDa |



