Reagents and instruments for immunology, cell biology and molecular biology.
 
> PBP (PEBP1) (NM_002567) Human Recombinant Protein

PBP (PEBP1) (NM_002567) Human Recombinant Protein

Print Print
Please log in

Cat# TP306355

Size : 20ug

Contact local distributor :


Phone :

PBP (PEBP1) (NM_002567) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP306355
Recombinant protein of human phosphatidylethanolamine binding protein 1 (PEBP1), 20 µg
 

Other products for "PBP or NM_002567"

Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206355 protein sequence
Red=Cloning site Green=Tags(s)

MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTD
PDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSN
RSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002558
Locus ID 5037
UniProt ID P30086
Cytogenetics 12q24.23
RefSeq Size 1507
RefSeq ORF 561
Synonyms HCNP; HCNPpp; HEL-210; HEL-S-34; HEL-S-96; PBP; PEBP; PEBP-1; RKIP
Summary This gene encodes a member of the phosphatidylethanolamine-binding family of proteins and has been shown to modulate multiple signaling pathways, including the MAP kinase (MAPK), NF-kappa B, and glycogen synthase kinase-3 (GSK-3) signaling pathways. The encoded protein can be further processed to form a smaller cleavage product, hippocampal cholinergic neurostimulating peptide (HCNP), which may be involved in neural development. This gene has been implicated in numerous human cancers and may act as a metastasis suppressor gene. Multiple pseudogenes of this gene have been identified in the genome. provided by RefSeq, Jul 2015
Protein Categories CAR-T Targets, Intracellular Proteins
FAQs
  • Protein FAQs
SDS
SKU Description Size
PH306355 PEBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002558) 10 ug
LC400913 Lyophilized PEBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY400913 Transient overexpression lysate of phosphatidylethanolamine binding protein 1 (PEBP1) (as WB positive control) 100 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT