Reagents and instruments for immunology, cell biology and molecular biology.
 
> PDCD2L (Programmed Cell Death Protein 2-like, MGC13096) (HRP)

PDCD2L (Programmed Cell Death Protein 2-like, MGC13096) (HRP)

Print Print
Please log in

Cat# 129624-HRP-100ul

Size : 100ul

Brand : US Biological

Contact local distributor :


Phone : +1 850 650 7790

129624-HRPPDCD2L (Programmed Cell Death Protein 2-like, MGC13096) (HRP)

Specifications
Clone TypeMonoclonal
Hostmouse
Sourcehuman
IsotypeIgG1,k
GradeAffinity Purified
ApplicationsE WB
CrossreactivityHu Mo Rt
Accession #BC006146, AAH06146
Shipping TempBlue Ice
Storage Temp-20°C

Over-expression suppresses AP1, CREB, NFAT, and NF-kB transcriptional activation, and delays cell cycle progression at S phase.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
CACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVP

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Applications
Product Type: Mab|Isotype: IgG1,k|Clone No: 5F9|Host: mouse|Source: human|Concentration: As reported|Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).|Purity: Purified by Protein A affinity chromatography.|Immunogen: Partial recombinant corresponding to aa80-179 from human MGC13096 (AAH06146) with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes human MGC13096. Species Crossreactivity: mouse and rat.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Partial recombinant corresponding to aa80-179 from human MGC13096 (AAH06146) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human MGC13096. Species Crossreactivity: mouse and rat.